Lineage for d4h0za_ (4h0z A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605913Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2605914Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2605915Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2606087Protein automated matches [190420] (9 species)
    not a true protein
  7. 2606125Species Momordica balsamina [TaxId:3672] [189375] (73 PDB entries)
  8. 2606171Domain d4h0za_: 4h0z A: [222319]
    automated match to d3mrwa_
    complexed with amu, nag

Details for d4h0za_

PDB Entry: 4h0z (more details), 2 Å

PDB Description: crystal structure of the complex of ribosome inactivating protein from momordica balsamina with n-acetyl muramic acid at 2.0 angstrom resolution
PDB Compounds: (A:) rRNA N-glycosidase

SCOPe Domain Sequences for d4h0za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h0za_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

SCOPe Domain Coordinates for d4h0za_:

Click to download the PDB-style file with coordinates for d4h0za_.
(The format of our PDB-style files is described here.)

Timeline for d4h0za_: