SCOPe 2.03: Domain d4h0za_: 4h0z A:

Lineage for d4h0za_ (4h0z A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species Momordica balsamina [TaxId:3672] [189375] (54 PDB entries)

8. Domain d4h0za_: 4h0z A: [222319]
   automated match to d3mrwa_
   complexed with amu, nag

Details for d4h0za_

PDB Entry: 4h0z, 2 Å

PDB Description: crystal structure of the complex of ribosome inactivating protein from momordica balsamina with n-acetyl muramic acid at 2.0 angstrom resolution

PDB Compounds: (A:) rRNA N-glycosidase

SCOPe Domain Sequences for d4h0za_:

Sequence; same for both SEQRES and ATOM records:

>d4h0za_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

Timeline for d4h0za_:

• d4h0za_ is new in SCOPe 2.03-stable
  
• d4h0za_ appears in SCOPe 2.04
  
• d4h0za_ appears in the current release, SCOPe 2.08