Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
Protein automated matches [227047] (4 species) not a true protein |
Species Dengue virus 1 [TaxId:11059] [226543] (2 PDB entries) |
Domain d4gt0b1: 4gt0 B:2-297 [222133] Other proteins in same PDB: d4gt0a2, d4gt0b2 automated match to d1urza2 complexed with cd, cl, nag |
PDB Entry: 4gt0 (more details), 2.57 Å
SCOPe Domain Sequences for d4gt0b1:
Sequence, based on SEQRES records: (download)
>d4gt0b1 f.10.1.0 (B:2-297) automated matches {Dengue virus 1 [TaxId: 11059]} rcvgignrdfveglsgatwvdvvlehgscvttmakdkptldiellktevtnpavlrklci eakisntttdsrcptqgeatlveeqdtnfvcrrtfvdrghgngcglfgkgslitcakfkc vtklegkivqyenlkysvivtvhtgdqhqvgnettehgtiatitpqaptseiqltdygal tldcsprtgldfnemvlltmkekswlvhkqwfldlplpwtsgastsqetwnrqdllvtfk tahakkqevvvlgsqegamhtaltgateiqtsgtttifaghlkcrlkmdkltlkgm
>d4gt0b1 f.10.1.0 (B:2-297) automated matches {Dengue virus 1 [TaxId: 11059]} rcvgignrdfveglsgatwvdvvlehgscvttmakdkptldiellktevtnpavlrklci eakisntttdsrcptqgeatlveeqdtnfvcrrtfvdrggngcglfgkgslitcakfkcv tklegkivqyenlkysvivtvhthgtiatitpqaptseiqltdygaltldcsprtgldfn emvlltmkekswlvhkqwfldlplpwtsgastsqetwnrqdllvtfktahakkqevvvlg sqegamhtaltgateiqtsgtttifaghlkcrlkmdkltlkgm
Timeline for d4gt0b1: