![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (39 species) not a true protein |
![]() | Species Dengue virus 1 [TaxId:11059] [226544] (2 PDB entries) |
![]() | Domain d4gt0a2: 4gt0 A:298-403 [222132] Other proteins in same PDB: d4gt0a1, d4gt0b1 automated match to d1urza1 complexed with cd, cl, nag |
PDB Entry: 4gt0 (more details), 2.57 Å
SCOPe Domain Sequences for d4gt0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gt0a2 b.1.18.0 (A:298-403) automated matches {Dengue virus 1 [TaxId: 11059]} syvmctgsfklekevaetqhgtvlvqvkyegtdapckipfssqdekgvtqngrlitanpi vtdkekpvnieaeppfgesyivvgagekalklswfkkgssigkmfe
Timeline for d4gt0a2: