Lineage for d4gria2 (4gri A:315-490)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003435Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2003436Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families) (S)
  5. 2003463Family a.97.1.0: automated matches [227179] (1 protein)
    not a true family
  6. 2003464Protein automated matches [226898] (6 species)
    not a true protein
  7. 2003465Species Borrelia burgdorferi [TaxId:224326] [226462] (1 PDB entry)
  8. 2003466Domain d4gria2: 4gri A:315-490 [222101]
    Other proteins in same PDB: d4gria1, d4grib1
    automated match to d1j09a1
    complexed with cl, glu, zn

Details for d4gria2

PDB Entry: 4gri (more details), 2.6 Å

PDB Description: crystal structure of a glutamyl-trna synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc
PDB Compounds: (A:) Glutamate--tRNA ligase

SCOPe Domain Sequences for d4gria2:

Sequence, based on SEQRES records: (download)

>d4gria2 a.97.1.0 (A:315-490) automated matches {Borrelia burgdorferi [TaxId: 224326]}
dyhkldffnsyyirekkdedlfnlllpffqkkgyvskpstleenqklkllipliksrikk
lsdalnmtkffyedikswnldeflsrkktakevcsilelikpilegfekrsseendkify
dfaesngfklgeillpiriaalgskvspplfdslkligkskvferiklaqeflrin

Sequence, based on observed residues (ATOM records): (download)

>d4gria2 a.97.1.0 (A:315-490) automated matches {Borrelia burgdorferi [TaxId: 224326]}
dyhkldffnsyyirekkdedlfnlllpffqkkgyvskpstleenqklkllipliksrikk
lsdalnmtkffyedikswnldefkevcsilelikpilegfekrsseendkifydfaesnl
geillpiriaalgskvspplfdslkligkskvferiklaqeflrin

SCOPe Domain Coordinates for d4gria2:

Click to download the PDB-style file with coordinates for d4gria2.
(The format of our PDB-style files is described here.)

Timeline for d4gria2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gria1