Lineage for d4gria1 (4gri A:3-314)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2860851Species Borrelia burgdorferi [TaxId:224326] [226461] (1 PDB entry)
  8. 2860852Domain d4gria1: 4gri A:3-314 [222100]
    Other proteins in same PDB: d4gria2, d4grib2
    automated match to d1glna2
    complexed with cl, glu, zn

Details for d4gria1

PDB Entry: 4gri (more details), 2.6 Å

PDB Description: crystal structure of a glutamyl-trna synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc
PDB Compounds: (A:) Glutamate--tRNA ligase

SCOPe Domain Sequences for d4gria1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gria1 c.26.1.0 (A:3-314) automated matches {Borrelia burgdorferi [TaxId: 224326]}
strvryapsptglqhiggirtalfnyffakscggkfllriedtdqsryspeaendlyssl
kwlgisfdegpvvggdyapyvqsqrsaiykqyakyliesghayycycsperlerikkiqn
inkmppgydrhcrnlsneevenalikkikpvvrfkiplegdtsfddillgritwankdis
pdpvilksdglptyhlanvvddylmkithvlraqewvssgplhvllykafkwkppiychl
pmvmgndgqklskrhgstalrqfiedgylpeaiinyvtllgwsyddkreffskndleqff
siekinkspaif

SCOPe Domain Coordinates for d4gria1:

Click to download the PDB-style file with coordinates for d4gria1.
(The format of our PDB-style files is described here.)

Timeline for d4gria1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gria2