![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
![]() | Protein automated matches [190459] (61 species) not a true protein |
![]() | Species Borrelia burgdorferi [TaxId:224326] [226461] (1 PDB entry) |
![]() | Domain d4gria1: 4gri A:3-314 [222100] Other proteins in same PDB: d4gria2, d4grib2 automated match to d1glna2 complexed with cl, glu, zn |
PDB Entry: 4gri (more details), 2.6 Å
SCOPe Domain Sequences for d4gria1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gria1 c.26.1.0 (A:3-314) automated matches {Borrelia burgdorferi [TaxId: 224326]} strvryapsptglqhiggirtalfnyffakscggkfllriedtdqsryspeaendlyssl kwlgisfdegpvvggdyapyvqsqrsaiykqyakyliesghayycycsperlerikkiqn inkmppgydrhcrnlsneevenalikkikpvvrfkiplegdtsfddillgritwankdis pdpvilksdglptyhlanvvddylmkithvlraqewvssgplhvllykafkwkppiychl pmvmgndgqklskrhgstalrqfiedgylpeaiinyvtllgwsyddkreffskndleqff siekinkspaif
Timeline for d4gria1: