Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.7: Actinoxanthin-like [49319] (1 family) automatically mapped to Pfam PF00960 |
Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins) |
Protein Neocarzinostatin [49323] (1 species) |
Species Streptomyces carzinostaticus [TaxId:1897] [49324] (7 PDB entries) |
Domain d1ncoa_: 1nco A: [22209] complexed with chr, mrd |
PDB Entry: 1nco (more details), 1.8 Å
SCOPe Domain Sequences for d1ncoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ncoa_ b.1.7.1 (A:) Neocarzinostatin {Streptomyces carzinostaticus [TaxId: 1897]} aaptatvtpssglsdgtvvkvagaglqagtaydvgqcawvdtgvlacnpadfssvtadan gsastsltvrrsfegflfdgtrwgtvdcttaacqvglsdaagngpegvaisfn
Timeline for d1ncoa_: