SCOPe 2.05: Domain d1suha_: 1suh A:

Lineage for d1suha_ (1suh A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.1: Cadherin [49314] (3 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)

8. Domain d1suha_: 1suh A: [22206]
   domain 1

Details for d1suha_

PDB Entry: 1suh

PDB Description: amino-terminal domain of epithelial cadherin in the calcium bound state, nmr, 20 structures

PDB Compounds: (A:) epithelial cadherin

SCOPe Domain Sequences for d1suha_:

Sequence; same for both SEQRES and ATOM records:

>d1suha_ b.1.6.1 (A:) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
dwvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwl
kvtqpldreaiakyilyshavssngeavedpmeivitvtdqndn

Timeline for d1suha_:

• d1suha_ first appeared (with stable ids) in SCOP 1.55, called d1suh__
  
• d1suha_ appears in SCOPe 2.04
  
• d1suha_ appears in SCOPe 2.06
  
• d1suha_ appears in the current release, SCOPe 2.08