Lineage for d1suha_ (1suh A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768942Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1768943Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 1768951Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 1768966Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)
  8. 1769012Domain d1suha_: 1suh A: [22206]
    domain 1

Details for d1suha_

PDB Entry: 1suh (more details)

PDB Description: amino-terminal domain of epithelial cadherin in the calcium bound state, nmr, 20 structures
PDB Compounds: (A:) epithelial cadherin

SCOPe Domain Sequences for d1suha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1suha_ b.1.6.1 (A:) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
dwvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwl
kvtqpldreaiakyilyshavssngeavedpmeivitvtdqndn

SCOPe Domain Coordinates for d1suha_:

Click to download the PDB-style file with coordinates for d1suha_.
(The format of our PDB-style files is described here.)

Timeline for d1suha_: