SCOPe 2.04: Domain d4gnia2: 4gni A:203-403

Lineage for d4gnia2 (4gni A:203-403)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (42 species)
   not a true protein

7. Species Chaetomium thermophilum [TaxId:759272] [226535] (1 PDB entry)

8. Domain d4gnia2: 4gni A:203-403 [222033]
   automated match to d1dkgd2
   complexed with atp, mg

Details for d4gnia2

PDB Entry: 4gni, 1.8 Å

PDB Description: Structure of the Ssz1 ATPase bound to ATP and Magnesium

PDB Compounds: (A:) Putative heat shock protein

SCOPe Domain Sequences for d4gnia2:

Sequence; same for both SEQRES and ATOM records:

>d4gnia2 c.55.1.0 (A:203-403) automated matches {Chaetomium thermophilum [TaxId: 759272]}
sdkiivvadlggsrsdvtvlasrsgmytilatvhdyeyhgialdkvlidhfskeflkknp
gakdprenprslaklrleaestkralsrstnasfsveslidgldfastinrlryetiart
vfegfnrlvesavkkagldpldvdevimsggtsntpriaanfryifpestrilapstdps
alnpselqargaalqasliqe

Timeline for d4gnia2:

• d4gnia2 first appeared in SCOPe 2.03
  
• d4gnia2 appears in SCOPe 2.05
  
• d4gnia2 appears in the current release, SCOPe 2.08