Lineage for d4gnia2 (4gni A:203-403)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. 1373385Species Chaetomium thermophilum [TaxId:759272] [226535] (1 PDB entry)
  8. 1373387Domain d4gnia2: 4gni A:203-403 [222033]
    automated match to d1dkgd2
    complexed with atp, mg

Details for d4gnia2

PDB Entry: 4gni (more details), 1.8 Å

PDB Description: Structure of the Ssz1 ATPase bound to ATP and Magnesium
PDB Compounds: (A:) Putative heat shock protein

SCOPe Domain Sequences for d4gnia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gnia2 c.55.1.0 (A:203-403) automated matches {Chaetomium thermophilum [TaxId: 759272]}
sdkiivvadlggsrsdvtvlasrsgmytilatvhdyeyhgialdkvlidhfskeflkknp
gakdprenprslaklrleaestkralsrstnasfsveslidgldfastinrlryetiart
vfegfnrlvesavkkagldpldvdevimsggtsntpriaanfryifpestrilapstdps
alnpselqargaalqasliqe

SCOPe Domain Coordinates for d4gnia2:

Click to download the PDB-style file with coordinates for d4gnia2.
(The format of our PDB-style files is described here.)

Timeline for d4gnia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gnia1