SCOP 1.61: Domain d1evub3: 1evu B:628-727

Lineage for d1evub3 (1evu B:628-727)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family)

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)

7. Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (7 PDB entries)

8. Domain d1evub3: 1evu B:628-727 [22178]
   Other proteins in same PDB: d1evua1, d1evua4, d1evub1, d1evub4

Details for d1evub3

PDB Entry: 1evu, 2.01 Å

PDB Description: human factor xiii with calcium bound in the ion site

SCOP Domain Sequences for d1evub3:

Sequence; same for both SEQRES and ATOM records:

>d1evub3 b.1.5.1 (B:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme}
tipeiiikvrgtqvvgsdmtvtvqftnplketlrnvwvhldgpgvtrpmkkmfreirpns
tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr

Timeline for d1evub3:

• d1evub3 first appeared (with stable ids) in SCOP 1.55
  
• d1evub3 appears in SCOP 1.59
  
• d1evub3 appears in SCOP 1.63
  
• d1evub3 appears in the current release, SCOPe 2.08