Lineage for d1evub3 (1evu B:628-727)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10036Superfamily b.1.5: Transglutaminase [49309] (1 family) (S)
  5. 10037Family b.1.5.1: Transglutaminase [49310] (1 protein)
  6. 10038Protein Coagulation factor XIII, two C-terminal domains [49311] (1 species)
  7. 10039Species Human (Homo sapiens), blood [TaxId:9606] [49312] (7 PDB entries)
  8. 10047Domain d1evub3: 1evu B:628-727 [22178]
    Other proteins in same PDB: d1evua1, d1evua4, d1evub1, d1evub4

Details for d1evub3

PDB Entry: 1evu (more details), 2.01 Å

PDB Description: human factor xiii with calcium bound in the ion site

SCOP Domain Sequences for d1evub3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evub3 b.1.5.1 (B:628-727) Coagulation factor XIII, two C-terminal domains {Human (Homo sapiens), blood}
tipeiiikvrgtqvvgsdmtvtvqftnplketlrnvwvhldgpgvtrpmkkmfreirpns
tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr

SCOP Domain Coordinates for d1evub3:

Click to download the PDB-style file with coordinates for d1evub3.
(The format of our PDB-style files is described here.)

Timeline for d1evub3: