Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) |
Species Escherichia coli [TaxId:562] [49306] (7 PDB entries) |
Domain d1f4hd2: 1f4h D:626-730 [22160] Other proteins in same PDB: d1f4ha3, d1f4ha4, d1f4ha5, d1f4hb3, d1f4hb4, d1f4hb5, d1f4hc3, d1f4hc4, d1f4hc5, d1f4hd3, d1f4hd4, d1f4hd5 |
PDB Entry: 1f4h (more details), 2.8 Å
SCOP Domain Sequences for d1f4hd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4hd2 b.1.4.1 (D:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d1f4hd2:
View in 3D Domains from same chain: (mouse over for more information) d1f4hd1, d1f4hd3, d1f4hd4, d1f4hd5 |