Lineage for d1f4hc2 (1f4h C:626-730)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) 
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) Species Escherichia coli [TaxId:562] [49306] (7 PDB entries) 
Domain d1f4hc2: 1f4h C:626-730 [22158]
Other proteins in same PDB: d1f4ha3, d1f4ha4, d1f4ha5, d1f4hb3, d1f4hb4, d1f4hb5, d1f4hc3, d1f4hc4, d1f4hc5, d1f4hd3, d1f4hd4, d1f4hd5
Details for d1f4hc2
PDB Entry: 1f4h (more details), 2.8 Å
PDB Description: e. coli (lacz) beta-galactosidase (orthorhombic)
SCOP Domain Sequences for d1f4hc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4hc2 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
SCOP Domain Coordinates for d1f4hc2:
Click to download the PDB-style file with coordinates for d1f4hc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f4hc2:
 View in 3DDomains from same chain: (mouse over for more information) d1f4hc1, d1f4hc3, d1f4hc4, d1f4hc5 |
