Lineage for d1f4hb4 (1f4h B:731-1023)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58106Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 58107Superfamily b.30.1: beta-Galactosidase, domain 5 [49994] (1 family) (S)
  5. 58108Family b.30.1.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 58109Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 58110Species Escherichia coli [TaxId:562] [49997] (7 PDB entries)
  8. 58152Domain d1f4hb4: 1f4h B:731-1023 [24387]
    Other proteins in same PDB: d1f4ha1, d1f4ha2, d1f4ha3, d1f4ha5, d1f4hb1, d1f4hb2, d1f4hb3, d1f4hb5, d1f4hc1, d1f4hc2, d1f4hc3, d1f4hc5, d1f4hd1, d1f4hd2, d1f4hd3, d1f4hd5

Details for d1f4hb4

PDB Entry: 1f4h (more details), 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (orthorhombic)

SCOP Domain Sequences for d1f4hb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4hb4 b.30.1.1 (B:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1f4hb4:

Click to download the PDB-style file with coordinates for d1f4hb4.
(The format of our PDB-style files is described here.)

Timeline for d1f4hb4: