SCOPe 2.04: Domain d4foea4: 4foe A:671-914

Lineage for d4foea4 (4foe A:671-914)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.3: Hexokinase [53083] (3 proteins)

6. Protein Mammalian type I hexokinase [53086] (2 species)
   further duplication: consists of two very similar lobes

7. Species Human (Homo sapiens) [TaxId:9606] [53087] (10 PDB entries)

8. Domain d4foea4: 4foe A:671-914 [221396]
   automated match to d1hkba4
   complexed with bgc, cit, m6d, na

Details for d4foea4

PDB Entry: 4foe, 2.7 Å

PDB Description: crystal structure of recombinant human hexokinase type i with mannose 6-phosphate

PDB Compounds: (A:) Hexokinase-1

SCOPe Domain Sequences for d4foea4:

Sequence; same for both SEQRES and ATOM records:

>d4foea4 c.55.1.3 (A:671-914) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]}
tcevglivgtgsnacymeemknvemvegdqgqmcinmewgafgdngclddirthydrlvd
eyslnagkqryekmisgmylgeivrnilidftkkgflfrgqisetlktrgifetkflsqi
esdrlallqvrailqqlglnstcddsilvktvcgvvsrraaqlcgagmaavvdkirenrg
ldrlnvtvgvdgtlyklhphfsrimhqtvkelspkcnvsfllsedgsgkgaalitavgvr
lrte

Timeline for d4foea4:

• d4foea4 first appeared in SCOPe 2.03
  
• d4foea4 appears in SCOPe 2.05
  
• d4foea4 appears in the current release, SCOPe 2.08