| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.3: Hexokinase [53083] (3 proteins) |
| Protein Mammalian type I hexokinase [53086] (2 species) further duplication: consists of two very similar lobes |
| Species Human (Homo sapiens) [TaxId:9606] [53087] (10 PDB entries) |
| Domain d4foea4: 4foe A:671-914 [221396] automated match to d1hkba4 complexed with bgc, cit, m6d, na |
PDB Entry: 4foe (more details), 2.7 Å
SCOPe Domain Sequences for d4foea4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4foea4 c.55.1.3 (A:671-914) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]}
tcevglivgtgsnacymeemknvemvegdqgqmcinmewgafgdngclddirthydrlvd
eyslnagkqryekmisgmylgeivrnilidftkkgflfrgqisetlktrgifetkflsqi
esdrlallqvrailqqlglnstcddsilvktvcgvvsrraaqlcgagmaavvdkirenrg
ldrlnvtvgvdgtlyklhphfsrimhqtvkelspkcnvsfllsedgsgkgaalitavgvr
lrte
Timeline for d4foea4:
View in 3DDomains from other chains: (mouse over for more information) d4foeb1, d4foeb2, d4foeb3, d4foeb4 |