SCOPe 2.07: Domain d4ffvc2: 4ffv C:107-210

Lineage for d4ffvc2 (4ffv C:107-210)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d4ffvc2: 4ffv C:107-210 [221187]
   Other proteins in same PDB: d4ffva1, d4ffva2, d4ffvb1, d4ffvb2, d4ffvc1, d4ffvl1
   automated match to d1z3gl2

Details for d4ffvc2

PDB Entry: 4ffv, 2.4 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dpp4, dpp-iv, cd26) in complex with 11a19 fab

PDB Compounds: (C:) 11A19 Fab light chain

SCOPe Domain Sequences for d4ffvc2:

Sequence, based on SEQRES records:

>d4ffvc2 b.1.1.2 (C:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Sequence, based on observed residues (ATOM records):

>d4ffvc2 b.1.1.2 (C:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgsegvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d4ffvc2:

• d4ffvc2 first appeared in SCOPe 2.03
  
• d4ffvc2 appears in SCOPe 2.06
  
• d4ffvc2 appears in the current release, SCOPe 2.08