| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (17 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries) |
| Domain d4ffvc2: 4ffv C:107-210 [221187] Other proteins in same PDB: d4ffva1, d4ffva2, d4ffvb1, d4ffvb2, d4ffvc1, d4ffvl1 automated match to d1z3gl2 |
PDB Entry: 4ffv (more details), 2.4 Å
SCOPe Domain Sequences for d4ffvc2:
Sequence, based on SEQRES records: (download)
>d4ffvc2 b.1.1.2 (C:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr
>d4ffvc2 b.1.1.2 (C:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgsegvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d4ffvc2: