Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
Protein automated matches [226870] (22 species) not a true protein |
Species Burkholderia thailandensis [TaxId:271848] [226396] (2 PDB entries) |
Domain d4f7db1: 4f7d B:16-115 [221058] Other proteins in same PDB: d4f7da2, d4f7db2 automated match to d1a8pa1 |
PDB Entry: 4f7d (more details), 2.35 Å
SCOPe Domain Sequences for d4f7db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f7db1 b.43.4.0 (B:16-115) automated matches {Burkholderia thailandensis [TaxId: 271848]} mskfdtatvlsvhhwtdtlfsftctrdqalrfnngeftmvglevdgkpltraysivspny eehleffsikvqngpltsrlqhlkvgdpvligkkptgtlv
Timeline for d4f7db1: