Lineage for d4f7db1 (4f7d B:16-115)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793672Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2793673Protein automated matches [226870] (22 species)
    not a true protein
  7. 2793709Species Burkholderia thailandensis [TaxId:271848] [226396] (2 PDB entries)
  8. 2793713Domain d4f7db1: 4f7d B:16-115 [221058]
    Other proteins in same PDB: d4f7da2, d4f7db2
    automated match to d1a8pa1

Details for d4f7db1

PDB Entry: 4f7d (more details), 2.35 Å

PDB Description: Crystal structure of ferredoxin-NADP reductase from burkholderia thailandensis E264
PDB Compounds: (B:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d4f7db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f7db1 b.43.4.0 (B:16-115) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mskfdtatvlsvhhwtdtlfsftctrdqalrfnngeftmvglevdgkpltraysivspny
eehleffsikvqngpltsrlqhlkvgdpvligkkptgtlv

SCOPe Domain Coordinates for d4f7db1:

Click to download the PDB-style file with coordinates for d4f7db1.
(The format of our PDB-style files is described here.)

Timeline for d4f7db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f7db2