SCOPe 2.08: Domain d4epta_: 4ept A:

Lineage for d4epta_ (4ept A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d4epta_: 4ept A: [220768]
   automated match to d4epva_
   complexed with 0qw, gdp, mg

Details for d4epta_

PDB Entry: 4ept, 2 Å

PDB Description: Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-mediated Activation

PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d4epta_:

Sequence; same for both SEQRES and ATOM records:

>d4epta_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkh

Timeline for d4epta_:

• d4epta_ first appeared in SCOPe 2.03
  
• d4epta_ appears in SCOPe 2.07