Lineage for d4eola1 (4eol A:1-297)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2218765Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 2218766Species Human (Homo sapiens) [TaxId:9606] [88856] (374 PDB entries)
    Uniprot P24941
  8. 2219112Domain d4eola1: 4eol A:1-297 [220759]
    Other proteins in same PDB: d4eola2, d4eolb1, d4eolb2, d4eolc2, d4eold1, d4eold2
    automated match to d4eokc_
    complexed with 1ro, mg, sgm

Details for d4eola1

PDB Entry: 4eol (more details), 2.4 Å

PDB Description: thr 160 phosphorylated cdk2 h84s, q85m, k89d - human cyclin a3 complex with the inhibitor ro3306
PDB Compounds: (A:) cyclin-dependent kinase 2

SCOPe Domain Sequences for d4eola1:

Sequence, based on SEQRES records: (download)

>d4eola1 d.144.1.7 (A:1-297) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfeflsmdlkdfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Sequence, based on observed residues (ATOM records): (download)

>d4eola1 d.144.1.7 (A:1-297) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirletegvpstaireisllkelnhpn
ivklldvihtenklylvfeflsmdlkdfmdasltgiplpliksylfqllqglafchshrv
lhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyysta
vdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkw
arqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

SCOPe Domain Coordinates for d4eola1:

Click to download the PDB-style file with coordinates for d4eola1.
(The format of our PDB-style files is described here.)

Timeline for d4eola1: