Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.3: PKD domain [49299] (1 family) |
Family b.1.3.1: PKD domain [49300] (3 proteins) Pfam PF00801 |
Protein Polycystein-1, PKD-1 [49301] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49302] (1 PDB entry) |
Domain d1b4ra_: 1b4r A: [22072] |
PDB Entry: 1b4r (more details)
SCOPe Domain Sequences for d1b4ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4ra_ b.1.3.1 (A:) Polycystein-1, PKD-1 {Human (Homo sapiens) [TaxId: 9606]} atlvgphgplasgqlaafhiaaplpvtatrwdfgdgsaevdaagpaashryvlpgryhvt avlalgagsallgtdvqvea
Timeline for d1b4ra_: