Lineage for d1b4ra_ (1b4r A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 9935Superfamily b.1.3: PKD domain [49299] (1 family) (S)
  5. 9936Family b.1.3.1: PKD domain [49300] (1 protein)
  6. 9937Protein Polycystein-1, PKD-1 [49301] (1 species)
  7. 9938Species Human (Homo sapiens) [TaxId:9606] [49302] (1 PDB entry)
  8. 9939Domain d1b4ra_: 1b4r A: [22072]

Details for d1b4ra_

PDB Entry: 1b4r (more details)

PDB Description: pkd domain 1 from human polycystein-1

SCOP Domain Sequences for d1b4ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4ra_ b.1.3.1 (A:) Polycystein-1, PKD-1 {Human (Homo sapiens)}
atlvgphgplasgqlaafhiaaplpvtatrwdfgdgsaevdaagpaashryvlpgryhvt
avlalgagsallgtdvqvea

SCOP Domain Coordinates for d1b4ra_:

Click to download the PDB-style file with coordinates for d1b4ra_.
(The format of our PDB-style files is described here.)

Timeline for d1b4ra_: