Lineage for d1bqub2 (1bqu B:100-215)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1767526Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1767569Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species)
  7. 1767570Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries)
  8. 1767574Domain d1bqub2: 1bqu B:100-215 [22069]
    complexed with gol, so4

Details for d1bqub2

PDB Entry: 1bqu (more details), 2 Å

PDB Description: cytokyne-binding region of gp130
PDB Compounds: (B:) protein (gp130)

SCOPe Domain Sequences for d1bqub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqub2 b.1.2.1 (B:100-215) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}
ykvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqippedt
astrssftvqdlkpfteyvfrircmkedgkgywsdwseeasgityedrpskepsfw

SCOPe Domain Coordinates for d1bqub2:

Click to download the PDB-style file with coordinates for d1bqub2.
(The format of our PDB-style files is described here.)

Timeline for d1bqub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bqub1