SCOP 1.59: Domain d1bqub1: 1bqu B:1-99

Lineage for d1bqub1 (1bqu B:1-99)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Cytokyne receptor gp130 cytokine-binding domains [49295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49296] (3 PDB entries)

8. Domain d1bqub1: 1bqu B:1-99 [22068]

Details for d1bqub1

PDB Entry: 1bqu, 2 Å

PDB Description: cytokyne-binding region of gp130

SCOP Domain Sequences for d1bqub1:

Sequence; same for both SEQRES and ATOM records:

>d1bqub1 b.1.2.1 (B:1-99) Cytokyne receptor gp130 cytokine-binding domains {Human (Homo sapiens)}
pgssglppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdt
ptsctvdystvyfvnievwveaenalgkvtsdhinfdpv

Timeline for d1bqub1:

• d1bqub1 first appeared (with stable ids) in SCOP 1.55
  
• d1bqub1 appears in SCOP 1.57
  
• d1bqub1 appears in SCOP 1.61
  
• d1bqub1 appears in the current release, SCOPe 2.08