![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries) |
![]() | Domain d1bqub1: 1bqu B:1-99 [22068] complexed with gol, so4 |
PDB Entry: 1bqu (more details), 2 Å
SCOPe Domain Sequences for d1bqub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bqub1 b.1.2.1 (B:1-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} pgssglppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdt ptsctvdystvyfvnievwveaenalgkvtsdhinfdpv
Timeline for d1bqub1: