Lineage for d4en0b_ (4en0 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386843Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2386844Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2387270Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2387271Protein automated matches [190873] (4 species)
    not a true protein
  7. 2387272Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)
  8. 2387322Domain d4en0b_: 4en0 B: [220675]
    automated match to d2re9a_
    complexed with gol, nag, po4

Details for d4en0b_

PDB Entry: 4en0 (more details), 2.59 Å

PDB Description: crystal structure of light
PDB Compounds: (B:) Tumor necrosis factor ligand superfamily member 14

SCOPe Domain Sequences for d4en0b_:

Sequence, based on SEQRES records: (download)

>d4en0b_ b.22.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
vgcplglastithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhlea
geevvvrvlderlvrlrdgtrsyfgafmv

Sequence, based on observed residues (ATOM records): (download)

>d4en0b_ b.22.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnpaahltgansssggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlggvgc
plstithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhleageevvv
rvlderlvrlrdgtrsyfgafmv

SCOPe Domain Coordinates for d4en0b_:

Click to download the PDB-style file with coordinates for d4en0b_.
(The format of our PDB-style files is described here.)

Timeline for d4en0b_: