SCOPe 2.06: Domain d4en0b_: 4en0 B:

Lineage for d4en0b_ (4en0 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.0: automated matches [191519] (1 protein)
   not a true family

6. Protein automated matches [190873] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)

8. Domain d4en0b_: 4en0 B: [220675]
   automated match to d2re9a_
   complexed with gol, nag, po4

Details for d4en0b_

PDB Entry: 4en0, 2.59 Å

PDB Description: crystal structure of light

PDB Compounds: (B:) Tumor necrosis factor ligand superfamily member 14

SCOPe Domain Sequences for d4en0b_:

Sequence, based on SEQRES records:

>d4en0b_ b.22.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
vgcplglastithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhlea
geevvvrvlderlvrlrdgtrsyfgafmv

Sequence, based on observed residues (ATOM records):

>d4en0b_ b.22.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnpaahltgansssggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlggvgc
plstithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhleageevvv
rvlderlvrlrdgtrsyfgafmv

Timeline for d4en0b_:

• d4en0b_ first appeared in SCOPe 2.03
  
• d4en0b_ appears in SCOPe 2.05
  
• d4en0b_ appears in SCOPe 2.07
  
• d4en0b_ appears in the current release, SCOPe 2.08