SCOPe 2.02: Domain d1bqua1: 1bqu A:5-99

Lineage for d1bqua1 (1bqu A:5-99)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries)

8. Domain d1bqua1: 1bqu A:5-99 [22066]
   complexed with gol, so4

Details for d1bqua1

PDB Entry: 1bqu, 2 Å

PDB Description: cytokyne-binding region of gp130

PDB Compounds: (A:) protein (gp130)

SCOPe Domain Sequences for d1bqua1:

Sequence; same for both SEQRES and ATOM records:

>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}
glppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdtptsc
tvdystvyfvnievwveaenalgkvtsdhinfdpv

Timeline for d1bqua1:

• d1bqua1 first appeared (with stable ids) in SCOP 1.55
  
• d1bqua1 appears in SCOPe 2.01
  
• d1bqua1 appears in SCOPe 2.03
  
• d1bqua1 appears in the current release, SCOPe 2.08