Lineage for d1bqua1 (1bqu A:5-99)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1109778Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1109779Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1109820Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species)
  7. 1109821Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries)
  8. 1109822Domain d1bqua1: 1bqu A:5-99 [22066]
    complexed with gol, so4

Details for d1bqua1

PDB Entry: 1bqu (more details), 2 Å

PDB Description: cytokyne-binding region of gp130
PDB Compounds: (A:) protein (gp130)

SCOPe Domain Sequences for d1bqua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}
glppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdtptsc
tvdystvyfvnievwveaenalgkvtsdhinfdpv

SCOPe Domain Coordinates for d1bqua1:

Click to download the PDB-style file with coordinates for d1bqua1.
(The format of our PDB-style files is described here.)

Timeline for d1bqua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bqua2