| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries) |
| Domain d1bqua1: 1bqu A:5-99 [22066] complexed with gol, so4 |
PDB Entry: 1bqu (more details), 2 Å
SCOPe Domain Sequences for d1bqua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}
glppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdtptsc
tvdystvyfvnievwveaenalgkvtsdhinfdpv
Timeline for d1bqua1: