SCOP 1.71: Domain d1fg9c2: 1fg9 C:110-224

Lineage for d1fg9c2 (1fg9 C:110-224)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (1 family)
Family b.1.2.1: Fibronectin type III [49266] (28 proteins)
Pfam 00041
Protein Interferon-gamma receptor alpha chain [49293] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries)
Domain d1fg9c2: 1fg9 C:110-224 [22061]
Other proteins in same PDB: d1fg9a_, d1fg9b_

Details for d1fg9c2

PDB Entry: 1fg9 (more details), 2.9 Å

PDB Description: 3:1 complex of interferon-gamma receptor with interferon-gamma dimer

SCOP Domain Sequences for d1fg9c2:

Sequence, based on SEQRES records: (download)

>d1fg9c2 b.1.2.1 (C:110-224) Interferon-gamma receptor alpha chain {Human (Homo sapiens)}
igppkldirkeekqimidifhpsvfvngdeqevdydpettcyirvynvyvrmngseiqyk
iltqkeddcdeiqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitifns

Sequence, based on observed residues (ATOM records): (download)

>d1fg9c2 b.1.2.1 (C:110-224) Interferon-gamma receptor alpha chain {Human (Homo sapiens)}
igppkldirkeekqimidifhpsvfvngdeqedpettcyirvynvyvrmngseiqykilt
qkeddcdeiqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitifns

SCOP Domain Coordinates for d1fg9c2:

Click to download the PDB-style file with coordinates for d1fg9c2.
(The format of our PDB-style files is described here.)

Timeline for d1fg9c2: