SCOPe 2.08: Domain d1fg9c2: 1fg9 C:110-224

Lineage for d1fg9c2 (1fg9 C:110-224)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Interferon-gamma receptor alpha chain [49293] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries)

8. Domain d1fg9c2: 1fg9 C:110-224 [22061]
   Other proteins in same PDB: d1fg9a_, d1fg9b_

Details for d1fg9c2

PDB Entry: 1fg9, 2.9 Å

PDB Description: 3:1 complex of interferon-gamma receptor with interferon-gamma dimer

PDB Compounds: (C:) interferon-gamma receptor alpha chain

SCOPe Domain Sequences for d1fg9c2:

Sequence, based on SEQRES records:

>d1fg9c2 b.1.2.1 (C:110-224) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
igppkldirkeekqimidifhpsvfvngdeqevdydpettcyirvynvyvrmngseiqyk
iltqkeddcdeiqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitifns

Sequence, based on observed residues (ATOM records):

>d1fg9c2 b.1.2.1 (C:110-224) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
igppkldirkeekqimidifhpsvfvngdeqedpettcyirvynvyvrmngseiqykilt
qkeddcdeiqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitifns

Timeline for d1fg9c2:

• d1fg9c2 first appeared (with stable ids) in SCOP 1.55
  
• d1fg9c2 appears in SCOPe 2.07