Class a: All alpha proteins [46456] (226 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (3 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins) contains an additional helix in one of the crossover connections |
Protein Interferon-gamma [47318] (3 species) intertwined dimer |
Species Human (Homo sapiens) [TaxId:9606] [47320] (4 PDB entries) |
Domain d1fg9a_: 1fg9 A: [16915] Other proteins in same PDB: d1fg9c1, d1fg9c2, d1fg9d1, d1fg9d2, d1fg9e1, d1fg9e2 |
PDB Entry: 1fg9 (more details), 2.9 Å
SCOP Domain Sequences for d1fg9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fg9a_ a.26.1.3 (A:) Interferon-gamma {Human (Homo sapiens)} mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmae lspaakt
Timeline for d1fg9a_: