SCOP 1.71: Domain d1fg9a_: 1fg9 A:

Lineage for d1fg9a_ (1fg9 A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-gamma [47318] (3 species)
   intertwined dimer

7. Species Human (Homo sapiens) [TaxId:9606] [47320] (4 PDB entries)

8. Domain d1fg9a_: 1fg9 A: [16915]
   Other proteins in same PDB: d1fg9c1, d1fg9c2, d1fg9d1, d1fg9d2, d1fg9e1, d1fg9e2

Details for d1fg9a_

PDB Entry: 1fg9, 2.9 Å

PDB Description: 3:1 complex of interferon-gamma receptor with interferon-gamma dimer

SCOP Domain Sequences for d1fg9a_:

Sequence; same for both SEQRES and ATOM records:

>d1fg9a_ a.26.1.3 (A:) Interferon-gamma {Human (Homo sapiens)}
mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmae
lspaakt

Timeline for d1fg9a_:

• d1fg9a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fg9a_ appears in SCOP 1.69
  
• d1fg9a_ appears in SCOP 1.73
  
• d1fg9a_ appears in the current release, SCOPe 2.08