SCOPe 2.03: Domain d1fyhe1: 1fyh E:12-109

Lineage for d1fyhe1 (1fyh E:12-109)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families)
Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
Pfam PF00041
Protein Interferon-gamma receptor alpha chain [49293] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries)
Domain d1fyhe1: 1fyh E:12-109 [22057]
Other proteins in same PDB: d1fyha1, d1fyha2, d1fyhd1, d1fyhd2
complexed with cl

Details for d1fyhe1

PDB Entry: 1fyh (more details), 2.04 Å

PDB Description: 1:1 complex between an interferon gamma single-chain variant and its receptor

PDB Compounds: (E:) interferon-gamma receptor alpha chain

SCOPe Domain Sequences for d1fyhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyhe1 b.1.2.1 (E:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
vptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycnis
dhvgdpsnslwvrvkarvgqkesayakseefavcrdgk

SCOPe Domain Coordinates for d1fyhe1:

Click to download the PDB-style file with coordinates for d1fyhe1.
(The format of our PDB-style files is described here.)

Timeline for d1fyhe1: