Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Interferon-gamma receptor alpha chain [49293] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries) |
Domain d1fyhb2: 1fyh B:110-223 [22056] Other proteins in same PDB: d1fyha1, d1fyha2, d1fyhd1, d1fyhd2 complexed with cl |
PDB Entry: 1fyh (more details), 2.04 Å
SCOPe Domain Sequences for d1fyhb2:
Sequence, based on SEQRES records: (download)
>d1fyhb2 b.1.2.1 (B:110-223) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} igppkldirkeekqimidifhpsvfvngdeqevdydpettcyirvynvyvrmngseiqyk iltqkeddcdeiqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitifn
>d1fyhb2 b.1.2.1 (B:110-223) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} igppkldirkeekqimidifhpsvfvettcyirvynvyvrmngseiqykiltqkeddcde iqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitifn
Timeline for d1fyhb2: