Lineage for d1fyhb1 (1fyh B:12-109)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 787437Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 787438Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
    Pfam PF00041
  6. 787725Protein Interferon-gamma receptor alpha chain [49293] (1 species)
  7. 787726Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries)
  8. 787727Domain d1fyhb1: 1fyh B:12-109 [22055]
    Other proteins in same PDB: d1fyha1, d1fyha2, d1fyhd1, d1fyhd2

Details for d1fyhb1

PDB Entry: 1fyh (more details), 2.04 Å

PDB Description: 1:1 complex between an interferon gamma single-chain variant and its receptor
PDB Compounds: (B:) interferon-gamma receptor alpha chain

SCOP Domain Sequences for d1fyhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
vptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycnis
dhvgdpsnslwvrvkarvgqkesayakseefavcrdgk

SCOP Domain Coordinates for d1fyhb1:

Click to download the PDB-style file with coordinates for d1fyhb1.
(The format of our PDB-style files is described here.)

Timeline for d1fyhb1: