Lineage for d4egjc1 (4egj C:4-102)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1842743Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1842744Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1843027Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 1843028Protein automated matches [226903] (28 species)
    not a true protein
  7. 1843042Species Burkholderia xenovorans [TaxId:266265] [226415] (1 PDB entry)
  8. 1843045Domain d4egjc1: 4egj C:4-102 [220510]
    Other proteins in same PDB: d4egja2, d4egjb2, d4egjc2, d4egjd2
    automated match to d1e4ea1

Details for d4egjc1

PDB Entry: 4egj (more details), 2.3 Å

PDB Description: crystal structure of d-alanine-d-alanine ligase from burkholderia xenovorans
PDB Compounds: (C:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4egjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4egjc1 c.30.1.0 (C:4-102) automated matches {Burkholderia xenovorans [TaxId: 266265]}
idpkqfgkvavllggnsaerevslnsgrlvlqglrdagidahpfdpaerplaalkeegfv
rafnalhggygengqiqgaldfygirytgsgvlgsalgl

SCOPe Domain Coordinates for d4egjc1:

Click to download the PDB-style file with coordinates for d4egjc1.
(The format of our PDB-style files is described here.)

Timeline for d4egjc1: