| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
| Protein automated matches [226903] (28 species) not a true protein |
| Species Burkholderia xenovorans [TaxId:266265] [226415] (1 PDB entry) |
| Domain d4egjd1: 4egj D:3-102 [220512] Other proteins in same PDB: d4egja2, d4egjb2, d4egjc2, d4egjd2 automated match to d1e4ea1 |
PDB Entry: 4egj (more details), 2.3 Å
SCOPe Domain Sequences for d4egjd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4egjd1 c.30.1.0 (D:3-102) automated matches {Burkholderia xenovorans [TaxId: 266265]}
sidpkqfgkvavllggnsaerevslnsgrlvlqglrdagidahpfdpaerplaalkeegf
vrafnalhggygengqiqgaldfygirytgsgvlgsalgl
Timeline for d4egjd1: