SCOPe 2.08: Domain d4egjc1: 4egj C:4-102

Lineage for d4egjc1 (4egj C:4-102)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226415] (1 PDB entry)

8. Domain d4egjc1: 4egj C:4-102 [220510]
   Other proteins in same PDB: d4egja2, d4egjb2, d4egjc2, d4egjd2
   automated match to d1e4ea1

Details for d4egjc1

PDB Entry: 4egj, 2.3 Å

PDB Description: crystal structure of d-alanine-d-alanine ligase from burkholderia xenovorans

PDB Compounds: (C:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4egjc1:

Sequence; same for both SEQRES and ATOM records:

>d4egjc1 c.30.1.0 (C:4-102) automated matches {Burkholderia xenovorans [TaxId: 266265]}
idpkqfgkvavllggnsaerevslnsgrlvlqglrdagidahpfdpaerplaalkeegfv
rafnalhggygengqiqgaldfygirytgsgvlgsalgl

Timeline for d4egjc1:

• d4egjc1 first appeared in SCOPe 2.03
  
• d4egjc1 appears in SCOPe 2.07