Lineage for d4ecib1 (4eci B:1-81)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134903Species Pseudomonas aeruginosa [TaxId:388272] [226354] (2 PDB entries)
  8. 2134907Domain d4ecib1: 4eci B:1-81 [220416]
    Other proteins in same PDB: d4ecia2, d4ecia3, d4ecib2, d4ecib3
    automated match to d1k0db2
    complexed with act

Details for d4ecib1

PDB Entry: 4eci (more details), 1.8 Å

PDB Description: Crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with acetate
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4ecib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ecib1 c.47.1.0 (B:1-81) automated matches {Pseudomonas aeruginosa [TaxId: 388272]}
midlytaatpnghkvsialeemglpyrvhalsfdkkeqkapeflrinpngripaivdrdn
ddfavfesgailiylaektgq

SCOPe Domain Coordinates for d4ecib1:

Click to download the PDB-style file with coordinates for d4ecib1.
(The format of our PDB-style files is described here.)

Timeline for d4ecib1: