SCOPe 2.06: Domain d4ecia1: 4eci A:1-81

Lineage for d4ecia1 (4eci A:1-81)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:388272] [226354] (2 PDB entries)

8. Domain d4ecia1: 4eci A:1-81 [220414]
   Other proteins in same PDB: d4ecia2, d4ecia3, d4ecib2, d4ecib3
   automated match to d1k0db2
   complexed with act

Details for d4ecia1

PDB Entry: 4eci, 1.8 Å

PDB Description: Crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with acetate

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d4ecia1:

Sequence; same for both SEQRES and ATOM records:

>d4ecia1 c.47.1.0 (A:1-81) automated matches {Pseudomonas aeruginosa [TaxId: 388272]}
midlytaatpnghkvsialeemglpyrvhalsfdkkeqkapeflrinpngripaivdrdn
ddfavfesgailiylaektgq

Timeline for d4ecia1:

• d4ecia1 first appeared in SCOPe 2.03
  
• d4ecia1 appears in SCOPe 2.05
  
• d4ecia1 appears in SCOPe 2.07
  
• d4ecia1 appears in the current release, SCOPe 2.08