Lineage for d4ec0b2 (4ec0 B:1076-1199)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1271151Protein automated matches [226848] (9 species)
    not a true protein
  7. 1271160Species Human (Homo sapiens) [TaxId:9606] [224956] (27 PDB entries)
  8. 1271190Domain d4ec0b2: 4ec0 B:1076-1199 [220413]
    Other proteins in same PDB: d4ec0a1, d4ec0b1
    automated match to d1pd211
    complexed with 7pq, gsh, mg

Details for d4ec0b2

PDB Entry: 4ec0 (more details), 1.85 Å

PDB Description: crystal structure of hh-pgds with water displacing inhibitor
PDB Compounds: (B:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d4ec0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ec0b2 a.45.1.1 (B:1076-1199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d4ec0b2:

Click to download the PDB-style file with coordinates for d4ec0b2.
(The format of our PDB-style files is described here.)

Timeline for d4ec0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ec0b1