SCOPe 2.03: Domain d4ec0b1: 4ec0 B:1000-1075

Lineage for d4ec0b1 (4ec0 B:1000-1075)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (58 PDB entries)

8. Domain d4ec0b1: 4ec0 B:1000-1075 [220412]
   Other proteins in same PDB: d4ec0a2, d4ec0b2
   automated match to d1pd212
   complexed with 7pq, gsh, mg

Details for d4ec0b1

PDB Entry: 4ec0, 1.85 Å

PDB Description: crystal structure of hh-pgds with water displacing inhibitor

PDB Compounds: (B:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d4ec0b1:

Sequence; same for both SEQRES and ATOM records:

>d4ec0b1 c.47.1.0 (B:1000-1075) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgl
tlhqslaiaryltknt

Timeline for d4ec0b1:

• d4ec0b1 is new in SCOPe 2.03-stable
  
• d4ec0b1 appears in SCOPe 2.04
  
• d4ec0b1 appears in the current release, SCOPe 2.08