SCOPe 2.07: Domain d1c8pa1: 1c8p A:2-102

Lineage for d1c8pa1 (1c8p A:2-102)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
   duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3

7. Species Human (Homo sapiens) [TaxId:9606] [49290] (5 PDB entries)

8. Domain d1c8pa1: 1c8p A:2-102 [22040]
   Other proteins in same PDB: d1c8pa2
   domain 4, the ligand-binding domain

Details for d1c8pa1

PDB Entry: 1c8p

PDB Description: nmr structure of the ligand binding domain of the common beta-chain in the gm-csf, il-3 and il-5 receptors

PDB Compounds: (A:) cytokine receptor common beta chain

SCOPe Domain Sequences for d1c8pa1:

Sequence; same for both SEQRES and ATOM records:

>d1c8pa1 b.1.2.1 (A:2-102) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}
iqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahsm
alpalepstrywarvrvrtsrtgyngiwsewsearswdtes

Timeline for d1c8pa1:

• d1c8pa1 first appeared (with stable ids) in SCOP 1.55, called d1c8pa_
  
• d1c8pa1 appears in SCOPe 2.06
  
• d1c8pa1 appears in the current release, SCOPe 2.08