Lineage for d1c8pa1 (1c8p A:2-102)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761690Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
    duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3
  7. 2761691Species Human (Homo sapiens) [TaxId:9606] [49290] (5 PDB entries)
  8. 2761710Domain d1c8pa1: 1c8p A:2-102 [22040]
    Other proteins in same PDB: d1c8pa2
    domain 4, the ligand-binding domain

Details for d1c8pa1

PDB Entry: 1c8p (more details)

PDB Description: nmr structure of the ligand binding domain of the common beta-chain in the gm-csf, il-3 and il-5 receptors
PDB Compounds: (A:) cytokine receptor common beta chain

SCOPe Domain Sequences for d1c8pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8pa1 b.1.2.1 (A:2-102) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}
iqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahsm
alpalepstrywarvrvrtsrtgyngiwsewsearswdtes

SCOPe Domain Coordinates for d1c8pa1:

Click to download the PDB-style file with coordinates for d1c8pa1.
(The format of our PDB-style files is described here.)

Timeline for d1c8pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c8pa2