SCOPe 2.03: Domain d4e8ba2: 4e8b A:74-244

Lineage for d4e8ba2 (4e8b A:74-244)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.5: YggJ C-terminal domain-like [89632] (4 proteins)
   contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain

6. Protein automated matches [227088] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [226466] (1 PDB entry)

8. Domain d4e8ba2: 4e8b A:74-244 [220359]
   Other proteins in same PDB: d4e8ba1
   automated match to d1vhya2

Details for d4e8ba2

PDB Entry: 4e8b, 2.25 Å

PDB Description: crystal structure of 16s rrna methyltransferase rsme from e.coli

PDB Compounds: (A:) Ribosomal RNA small subunit methyltransferase E

SCOPe Domain Sequences for d4e8ba2:

Sequence; same for both SEQRES and ATOM records:

>d4e8ba2 c.116.1.5 (A:74-244) automated matches {Escherichia coli [TaxId: 83333]}
resplhihlgqvmsrgekmeftiqksielgvslitplfsercgvkldserlnkklqqwqk
iaiaaceqcgrnrvpeirpamdleawcaeqdeglklnlhprasnsintlplpvervrlli
gpegglsadeiamtaryqftdillgprvlrtettaltaitalqvrfgdlgl

Timeline for d4e8ba2:

• d4e8ba2 is new in SCOPe 2.03-stable
  
• d4e8ba2 appears in SCOPe 2.04
  
• d4e8ba2 appears in the current release, SCOPe 2.08