|  | Class h: Coiled coil proteins [57942] (7 folds) | 
|  | Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices | 
|  | Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family)  | 
|  | Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) | 
|  | Protein Surfactant protein [57949] (2 species) | 
|  | Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (24 PDB entries) | 
|  | Domain d4e52b1: 4e52 B:204-234 [220309] Other proteins in same PDB: d4e52a2, d4e52b2, d4e52c2 automated match to d1pwba2 complexed with ca, gmh, kd5 | 
PDB Entry: 4e52 (more details), 1.7 Å
SCOPe Domain Sequences for d4e52b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e52b1 h.1.1.1 (B:204-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
vaslrqqvealqgqvqhlqaafsqykkvelf
Timeline for d4e52b1:
|  View in 3D Domains from other chains: (mouse over for more information) d4e52a1, d4e52a2, d4e52c1, d4e52c2 |