SCOPe 2.03: Domain d4e52b1: 4e52 B:204-234

Lineage for d4e52b1 (4e52 B:204-234)

1. Root: SCOPe 2.03

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family)

5. Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)

6. Protein Surfactant protein [57949] (2 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (24 PDB entries)

8. Domain d4e52b1: 4e52 B:204-234 [220309]
   Other proteins in same PDB: d4e52a2, d4e52b2, d4e52c2
   automated match to d1pwba2
   complexed with ca, gmh, kd5

Details for d4e52b1

PDB Entry: 4e52, 1.7 Å

PDB Description: crystal structure of haemophilus eagan 4a polysaccharide bound human lung surfactant protein d

PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d4e52b1:

Sequence; same for both SEQRES and ATOM records:

>d4e52b1 h.1.1.1 (B:204-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
vaslrqqvealqgqvqhlqaafsqykkvelf

Timeline for d4e52b1:

• d4e52b1 is new in SCOPe 2.03-stable
  
• d4e52b1 appears in SCOPe 2.04
  
• d4e52b1 appears in the current release, SCOPe 2.08