SCOPe 2.04: Domain d4e1jc1: 4e1j C:7-274

Lineage for d4e1jc1 (4e1j C:7-274)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (42 species)
   not a true protein

7. Species Sinorhizobium meliloti [TaxId:266834] [226334] (1 PDB entry)

8. Domain d4e1jc1: 4e1j C:7-274 [220151]
   automated match to d1glfo1
   complexed with cl, gol, na

Details for d4e1jc1

PDB Entry: 4e1j, 2.33 Å

PDB Description: crystal structure of glycerol kinase in complex with glycerol from sinorhizobium meliloti 1021

PDB Compounds: (C:) glycerol kinase

SCOPe Domain Sequences for d4e1jc1:

Sequence; same for both SEQRES and ATOM records:

>d4e1jc1 c.55.1.0 (C:7-274) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
hssgvdlgtenlyfqsmmggyilaidqgttstraivfdgnqkiagvgqkefkqhfpksgw
vehdpeeiwqtvvstvkeaieksgitandiaaigitnqretvvvwdretgkpihnaivwq
drrtaafcdklkkkglektfvkktgllldpyfsgtklnwllsnvkgaqvraakgelcfgt
idtfliwrltggecfctdatnasrtllyniaenawddeltevlrvpkemlpevkdcaadf
gvtdpslfgaaipilgvagdqqaatigq

Timeline for d4e1jc1:

• d4e1jc1 first appeared in SCOPe 2.03
  
• d4e1jc1 appears in SCOPe 2.05
  
• d4e1jc1 appears in the current release, SCOPe 2.08